PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010934555.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family HD-ZIP
Protein Properties Length: 882aa    MW: 97139.2 Da    PI: 5.891
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010934555.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.94e-19182237156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe+lF++ ++p++++r eL+k+l L++rqVk+WFqNrR++ k
  XP_010934555.1 182 KKRYHRHTAQQIQELETLFKEYPHPNEKQRLELSKQLCLDTRQVKFWFQNRRTQLK 237
                     688999**********************************************9987 PP

2START170.41.2e-533926171206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela++a++elvk+a++e+p+W        e++n+ e++q f++  +     + +ea r+s vv+ ++  lve+l+d   +W  +++    + +t+
  XP_010934555.1 392 ELALAAMEELVKMAQLEDPLWIPNLeggkEMLNYNEYYQVFPRIIGvkpigYVSEATRESEVVIINSQVLVETLMDAT-RWADMFPtliaRSATI 485
                     5899******************9999***************998779*******************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE- CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwveh 169
                     ++i+sg      galqlm aelq+lsplvp     f+Ry++q+ + +w++vdvS+d  ++ p     ++ +++lpSg++++ +sng+sk+twveh
  XP_010934555.1 486 DTICSGmdgsknGALQLMHAELQVLSPLVPiHSIDFLRYCKQQAENVWAVVDVSIDCGNNYPPsAGTYMSCRRLPSGCIVQNMSNGYSKITWVEH 580
                     *******************************************************998877775889**************************** PP

                     EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 170 vdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     ++++++ +h l+r+l++sgla ga+ wv+ l+r ce+
  XP_010934555.1 581 TEYDESGVHPLYRPLLRSGLALGARSWVSSLRRRCEC 617
                     **********************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.6E-20167239IPR009057Homeodomain-like
SuperFamilySSF466891.67E-18175243IPR009057Homeodomain-like
PROSITE profilePS5007117.54179239IPR001356Homeobox domain
SMARTSM003892.2E-15180243IPR001356Homeobox domain
CDDcd000861.44E-16182239No hitNo description
PfamPF000461.3E-16182237IPR001356Homeobox domain
PROSITE patternPS000270214237IPR017970Homeobox, conserved site
PROSITE profilePS5084840.286383620IPR002913START domain
CDDcd088756.73E-107387616No hitNo description
SuperFamilySSF559612.68E-29389618No hitNo description
SMARTSM002341.2E-36392617IPR002913START domain
PfamPF018526.8E-45392617IPR002913START domain
SuperFamilySSF559612.1E-16650847No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 882 aa     Download sequence    Send to blast
MILVSAIHKN FFGMASASTV HDSYSPSINR GEKETPDKLS KGSVLAPIDV LFRTSSPVKN  60
PSSSFFAEDP SISSSIEDPS TSSFIEDSFI SFSIEDPFIS SSFKEIKSDI THLDFSSNRL  120
ETNMKGQDEM SQLGVIGGVG DGSGDKDSMS RNREDENTNN LETNSLKEIS INDLDQENPR  180
KKKRYHRHTA QQIQELETLF KEYPHPNEKQ RLELSKQLCL DTRQVKFWFQ NRRTQLKTQI  240
EHHENSILRQ ENEKLKSENM TIRDAMINPC CNSCGGPTIL GEVSLEEKNL RIENARLKDE  300
INRVYSLAKK FLGRAMSSLD NPISPIMPNS ALELVIGNNS FNGFDMISTL PTMLDFVPRA  360
SNPMVSITTS STRNYGILGG ADKSNKRSIL LELALAAMEE LVKMAQLEDP LWIPNLEGGK  420
EMLNYNEYYQ VFPRIIGVKP IGYVSEATRE SEVVIINSQV LVETLMDATR WADMFPTLIA  480
RSATIDTICS GMDGSKNGAL QLMHAELQVL SPLVPIHSID FLRYCKQQAE NVWAVVDVSI  540
DCGNNYPPSA GTYMSCRRLP SGCIVQNMSN GYSKITWVEH TEYDESGVHP LYRPLLRSGL  600
ALGARSWVSS LRRRCECIAN LISSFTTDEH SAALSGGGKR SMLRLARRMT DSFCAGVCAW  660
ATHGWRELTA GSFGEDVRVM TRKSVNNPGE PQGVVLSAAT SVLVPVPPQR LFDFLRDERR  720
RGEWDILSNG GPMQEVLRVA KGHHAAIAVS LLRPSVVGAS ETSMLILQDT CTDASVSLVV  780
YAPVDVSAMH VVMNGGDPAY VAFLPSGFAI LPDGSGGRAT TVKSRAGELA ESPAGGSLLT  840
VAFQILVSSN LNDNPKDESV KTVSNLMSCT IQNIKTAVQC EN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010934555.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLA5BH090.0A5BH09_VITVI; Putative uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein